|
Артикул
|
Наименование |
Производитель
|
|---|---|---|
| CPV770Ge11 |
CPV770Ge11
BSA Conjugated Pramlintide (PLT)
Источник (хозяин): -
Организм: для всех
Фрагмент: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-(NH2)
Теги: N-концевой His-Tag
Биоактивность: нет
Производитель:Cloud-Clone Corp.
|
Cloud-Clone Corp. |
| CPV770Ge21 |
CPV770Ge21
OVA Conjugated Pramlintide (PLT)
Источник (хозяин): -
Организм: для всех
Фрагмент: PILPPTNVGSNTYC
Теги: N-концевой His-Tag
Биоактивность: нет
Производитель:Cloud-Clone Corp.
|
Cloud-Clone Corp. |
Pramlintide (PLT)
Описание и характеристики антигена PLT
Английские синонимы
Symlin
Pramlintide is a relatively new adjunct for diabetes, Pramlintide is delivered as an acetate salt. Pramlintide is an analogue of amylin, a small peptide hormone that is released into the bloodstream by the β-cells of the pancreas along with insulin, after a meal. Like insulin, amylin is completely absent in individuals with Type I diabetes. Reduction in glycated hemoglobin and weight loss have been shown in insulin-treated patients with type 2 diabetes taking pramlintide as an adjunctive therapy. By augmenting endogenous amylin, pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety via hypothalamic receptors (different receptors than for GLP-1), and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin and amylin. Pramlintide also has effects in raising the acute first-phase insulin response threshold following a meal.
Если вы не увидели здесь нужный Вам продукт - это значит, что он доступен для изготовления на заказ.
